• Home
  • Shop
  • About
  • FAQ
  • Contact
  • Compare Peptides
  • Wholesale
  • LL-37 Peptide: The Complete Research Guide to the Human Cathelicidin Antimicrobial Peptide

    Research Use Only β€” Informational Content: The information in this article is intended for educational and research purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. Iron Peak Peptides products are strictly for laboratory and scientific research β€” not for human consumption. Consult a licensed healthcare provider before starting any treatment or therapy. These statements have not been evaluated by the FDA.

    LL-37 Peptide: The Complete Research Guide to the Human Cathelicidin Antimicrobial Peptide

    All compounds discussed in this article are for research purposes only and are not for human consumption.

    Introduction

    In the ongoing battle against antibiotic-resistant microorganisms, researchers have increasingly turned their attention to the body’s own arsenal of antimicrobial defenses. Among these endogenous weapons, one peptide has emerged as a focal point of intense scientific investigation: LL-37, the only cathelicidin antimicrobial peptide found in humans. Named for its 37-amino acid sequence beginning with two leucine residues, LL-37 represents a critical component of the innate immune system with remarkably diverse biological functions.

    Since its identification in the mid-1990s, LL-37 has generated thousands of peer-reviewed publications exploring its broad-spectrum antimicrobial activity against bacteria, fungi, and viruses, as well as its roles in immunomodulation, wound healing, anti-biofilm activity, and even cancer biology. What makes LL-37 particularly fascinating to researchers is its multifunctionality β€” it does far more than simply kill pathogens. It serves as a bridge between innate and adaptive immunity, recruits immune cells to sites of infection, neutralizes bacterial toxins, and promotes tissue repair.

    This comprehensive research guide examines the current state of LL-37 science, from its molecular structure and mechanism of action to published clinical trial data. Whether exploring antimicrobial peptide research for the first time or seeking deeper understanding of cathelicidin biology, this article provides a thorough overview of what the scientific literature has revealed about this remarkable host defense peptide.

    What Is LL-37? Structure and Origin

    Discovery and Nomenclature

    The story of LL-37 begins with the broader cathelicidin family, a group of antimicrobial peptides found across numerous vertebrate species. The cathelicidins were first identified in the early 1990s when researchers discovered lipopolysaccharide (LPS)-binding proteins in rabbit granulocytes. However, while many species produce multiple cathelicidins, humans possess only a single member of this family.

    The human cathelicidin gene CAMP (cathelicidin antimicrobial peptide) encodes a precursor protein known as hCAP-18 (human Cationic Antimicrobial Protein of 18 kDa). In 1995, Gudmundsson and colleagues first characterized the human cathelicidin gene FALL39 and described the processing of the cathelin precursor to produce the mature antimicrobial peptide in granulocytes. Subsequent research by SΓΈrensen et al. (2001) demonstrated that hCAP-18 is cleaved extracellularly by the serine protease proteinase 3 to release the active C-terminal fragment β€” the 37-amino acid peptide beginning with two leucine (L) residues, hence the designation β€œLL-37.”

    SΓΈrensen OE et al. β€œHuman cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3.” Blood, 97(12), 3951-3959, 2001.

    Molecular Structure

    LL-37 is a 37-residue peptide with the amino acid sequence: [LL-37, 37 aa] It carries a net positive charge of +6 at physiological pH, which is critical for its interaction with negatively charged microbial membranes. The peptide has a molecular weight of approximately 4.5 kDa.

    Structurally, LL-37 adopts an alpha-helical amphipathic conformation in membrane-mimicking environments and in the presence of lipid bilayers. This means one face of the helix is hydrophobic while the other is hydrophilic β€” a structural arrangement that is essential for its ability to interact with and disrupt biological membranes. In aqueous solution, LL-37 is largely unstructured but rapidly folds into its helical form upon encountering lipid membranes or at higher concentrations where it can self-associate.

    Research by Shahmiri et al. (2016) using advanced biophysical techniques demonstrated that LL-37 exhibits two distinct interaction pathways depending on membrane composition: pore formation in bilayers of unsaturated phospholipids and membrane modulation in other lipid environments.

    Shahmiri M et al. β€œMembrane core-specific antimicrobial action of cathelicidin LL-37 peptide switches between pore and nanofibre formation.” Scientific Reports, 6, 38184, 2016.

    Sources of Production

    LL-37 is produced by a variety of cell types throughout the body, reflecting its importance in host defense at multiple anatomical sites:

    • Neutrophils: The primary source, where hCAP-18 is stored in specific (secondary) granules at concentrations of approximately 630 ΞΌg per 10⁹ cells and released upon cell activation

    • Epithelial cells: Including keratinocytes, respiratory epithelial cells, intestinal epithelial cells, and urogenital epithelium

    • Macrophages and monocytes: Key innate immune cells that produce LL-37 in response to infection

    • Mast cells, NK cells, and lymphocytes: Additional immune cell sources

    • Body fluids: Detected in sweat, saliva, airway surface liquid, seminal plasma, and breast milk

    The expression of LL-37 is upregulated during inflammation, infection, and injury β€” ensuring higher concentrations at sites where antimicrobial defense is most needed.

    Mechanism of Action

    Membrane Disruption: The Primary Antimicrobial Mechanism

    The antimicrobial activity of LL-37 centers on its ability to interact with and disrupt microbial cell membranes. This mechanism has been studied extensively and involves several key steps:

    1. Electrostatic Attraction: The cationic (+6 charge) LL-37 peptide is electrostatically attracted to the anionic (negatively charged) surfaces of bacterial membranes. Gram-negative bacteria present lipopolysaccharide (LPS) on their outer membranes, while Gram-positive bacteria display lipoteichoic acid β€” both carrying negative charges that attract LL-37. This selectivity is important because mammalian cell membranes are comparatively neutral due to the predominance of zwitterionic phospholipids.

    2. Membrane Insertion and Disruption: Once bound, the amphipathic alpha-helical structure of LL-37 allows it to insert into the lipid bilayer. Research has described multiple models for how LL-37 then disrupts membrane integrity, including the β€œtoroidal pore” model and the β€œcarpet” model. Shahmiri et al. (2016) demonstrated that the specific mechanism depends on membrane lipid composition β€” LL-37 forms discrete pores in some membrane types and causes broader membrane dissolution in others.

    3. Cell Death: Membrane disruption leads to loss of membrane potential, leakage of intracellular contents, and ultimately microbial cell death. Importantly, because this mechanism targets fundamental membrane architecture rather than specific molecular targets, the development of resistance is significantly more difficult compared to conventional antibiotics.

    Immunomodulatory Signaling

    Beyond direct antimicrobial killing, LL-37 functions as a potent immunomodulatory molecule. Scott et al. (2002) published foundational work demonstrating that LL-37 is a multifunctional modulator of innate immune responses, directly upregulating 29 genes and downregulating 20 others in human cells.

    Scott MG et al. β€œThe human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses.” Journal of Immunology, 169(7), 3883-3891, 2002.

    Key immunomodulatory activities identified in the research literature include:

    • Chemotaxis: LL-37 acts as a chemoattractant for neutrophils, monocytes, mast cells, and T cells, recruiting immune cells to sites of infection. It has been identified as a functional ligand for the formyl peptide receptor-like 1 (FPRL1) receptor.

    • Cytokine modulation: LL-37 exhibits both pro-inflammatory and anti-inflammatory effects depending on context. Research by Mookherjee et al. (2009) demonstrated that LL-37 selectively modulates the inflammatory response of neutrophils, controlling the release of inflammatory mediators while enhancing antimicrobial functions.

    • Dendritic cell activation: LL-37 can influence the maturation and function of dendritic cells, bridging innate and adaptive immunity.

    • Anti-endotoxin activity: LL-37 binds and neutralizes lipopolysaccharide (LPS), potentially reducing harmful inflammatory responses to bacterial components.

    Mookherjee N et al. β€œThe antimicrobial peptide LL-37 modulates the inflammatory and host defense response of human neutrophils.” Clinical Immunology, 130(3), 338-346, 2009.

    Receptor Interactions

    LL-37 interacts with multiple cell-surface receptors to exert its immunomodulatory effects:

    • FPRL1/FPR2 (Formyl Peptide Receptor Like-1): Mediates chemotactic and anti-apoptotic effects

    • P2X7 receptor: Involved in LL-37’s activation of the inflammasome

    • EGFR (Epidermal Growth Factor Receptor): Tjabringa et al. (2003) demonstrated that LL-37 activates innate immunity at the airway epithelial surface through transactivation of EGFR, contributing to wound healing responses

    • TLR (Toll-Like Receptors): LL-37 can complex with self-DNA and self-RNA to activate TLR9 and TLR7/8, respectively, amplifying immune responses

    Tjabringa GS et al. β€œThe antimicrobial peptide LL-37 activates innate immunity at the airway epithelial surface by transactivation of the epidermal growth factor receptor.” Journal of Immunology, 171(12), 6690-6696, 2003.

    The Vitamin D Connection

    One of the most significant discoveries in LL-37 biology was the identification of vitamin D as a key regulator of cathelicidin expression. In a landmark 2006 study published in Science, Liu et al. demonstrated that Toll-like receptor activation in human macrophages triggers a vitamin D-dependent antimicrobial pathway that leads to upregulation of cathelicidin/LL-37 expression. This finding provided a molecular explanation for the long-observed connection between vitamin D deficiency and increased susceptibility to infections.

    Liu PT et al. β€œToll-like receptor triggering of a vitamin D-mediated human antimicrobial response.” Science, 311(5768), 1770-1773, 2006.

    The human CAMP gene promoter contains a vitamin D response element (VDRE), meaning that the active form of vitamin D (1,25-dihydroxyvitamin D₃) directly drives transcription of the LL-37 precursor. This regulatory mechanism is unique to primates β€” the mouse cathelicidin gene lacks this VDRE, which has important implications for translating research findings across species.

    Published Research Findings

    Antibacterial Activity

    LL-37 demonstrates broad-spectrum antibacterial activity against both Gram-positive and Gram-negative organisms. Research has documented activity against clinically significant pathogens including Staphylococcus aureus (including methicillin-resistant strains), Pseudomonas aeruginosa, Escherichia coli, Streptococcus species, and Mycobacterium tuberculosis.

    Turner et al. (1998) published early work characterizing the antibacterial activities of LL-37, demonstrating minimum inhibitory concentrations in the low micromolar range against a panel of clinically relevant bacteria. Subsequent studies expanded these findings considerably.

    Turner J et al. β€œActivities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophils.” Antimicrobial Agents and Chemotherapy, 42(9), 2206-2214, 1998.

    Research by Liu and colleagues (2021) evaluated LL-37 specifically against Staphylococcus aureus biofilm-forming strains, reporting minimum inhibitory concentrations of approximately 0.62 ΞΌM and demonstrating both antimicrobial and anti-biofilm efficacy in vitro.

    One area of particular research interest is LL-37’s activity against Mycobacterium tuberculosis. Liu et al. (2007) demonstrated that vitamin D-mediated antimicrobial activity against M. tuberculosis is dependent on the induction of cathelicidin, establishing a direct link between vitamin D status, LL-37 levels, and defense against tuberculosis.

    Liu PT et al. β€œCutting edge: vitamin D-mediated human antimicrobial activity against Mycobacterium tuberculosis is dependent on the induction of cathelicidin.” Journal of Immunology, 179(4), 2060-2063, 2007.

    Anti-Biofilm Research

    Bacterial biofilms represent one of the greatest challenges in modern medicine, as bacteria within biofilms can be up to 1,000 times more resistant to antibiotics than their planktonic counterparts. Research into LL-37’s anti-biofilm properties has yielded compelling results.

    The seminal study by Overhage et al. (2008) demonstrated that LL-37 prevents Pseudomonas aeruginosa biofilm formation through multiple mechanisms: decreasing bacterial cell attachment, stimulating twitching motility (which disrupts organized biofilm architecture), and influencing two major quorum-sensing systems (las and rhl). Notably, these anti-biofilm effects occurred at concentrations well below the minimum inhibitory concentration for planktonic bacteria, suggesting a distinct mechanism from direct antimicrobial killing.

    Overhage J et al. β€œHuman host defense peptide LL-37 prevents bacterial biofilm formation.” Infection and Immunity, 76(9), 4176-4182, 2008.

    A comprehensive review by Ridyard and Overhage (2021) in Antibiotics summarized the extensive body of evidence supporting LL-37’s dual antimicrobial and anti-biofilm potential, noting that the peptide affects biofilm formation at sub-inhibitory concentrations by modulating bacterial gene expression and behavior rather than solely through bactericidal activity.

    Ridyard KE, Overhage J. β€œThe potential of human peptide LL-37 as an antimicrobial and anti-biofilm agent.” Antibiotics, 10(6), 650, 2021.

    Antiviral Activity

    Research has revealed that LL-37 possesses significant antiviral activity against multiple virus families, expanding its relevance beyond antibacterial defense.

    Influenza A Virus: Tripathi et al. (2013) demonstrated dose-related neutralizing activity of LL-37 against several seasonal and mouse-adapted influenza A virus strains. The antiviral mechanism involved direct disruption of viral membranes β€” a mechanism distinct from that of other innate immune molecules like surfactant protein D or defensins. Electron microscopy studies showed that LL-37 caused visible disruption of viral membrane integrity.

    Tripathi S et al. β€œThe human cathelicidin LL-37 inhibits influenza A viruses through a mechanism distinct from that of surfactant protein D or defensins.” Journal of General Virology, 94(Pt 1), 40-49, 2013.

    Barlow et al. (2011) extended these findings in an animal model, demonstrating that LL-37 improved outcomes of influenza infection in mice through inhibition of viral replication and reduction of virus-induced pro-inflammatory cytokine generation in the lungs.

    Barlow PG et al. β€œAntiviral activity and increased host defense against influenza infection elicited by the human cathelicidin LL-37.” PLoS ONE, 6(10), e25333, 2011.

    Respiratory Syncytial Virus (RSV): Currie et al. (2013) demonstrated effective antiviral activity of LL-37 against RSV in vitro, with activity retained by truncated central peptide fragments.

    Currie SM et al. β€œThe human cathelicidin LL-37 has antiviral activity against respiratory syncytial virus.” PLoS ONE, 8(8), e73659, 2013.

    HIV-1: Bergman et al. (2007) reported that LL-37 inhibits HIV-1 replication in vitro, adding to the growing body of evidence for LL-37’s broad-spectrum antiviral properties.

    Bergman P et al. β€œThe antimicrobial peptide LL-37 inhibits HIV-1 replication.” Current HIV Research, 5(4), 410-415, 2007.

    Wound Healing Research

    LL-37 plays a documented role in wound healing processes, making it a subject of particular interest for regenerative medicine research. This area of study has parallels with other peptides investigated for tissue repair, including BPC-157 and TB-500, which have also been studied for their regenerative properties.

    Heilborn et al. (2003) published a critical study in the Journal of Investigative Dermatology demonstrating that LL-37 is involved in re-epithelialization of human skin wounds and is notably absent in chronic ulcer epithelium. This finding suggested that deficient LL-37 expression may contribute to impaired wound healing.

    Heilborn JD et al. β€œThe cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium.” Journal of Investigative Dermatology, 120(3), 379-389, 2003.

    This observation led to clinical trials of topical LL-37 for chronic wounds. GrΓΆnberg et al. (2014) reported results of a randomized, placebo-controlled clinical trial demonstrating that topical treatment with LL-37 for chronic venous leg ulcers was safe and well tolerated, with marked effects on healing predictors at the two lower doses tested.

    GrΓΆnberg A et al. β€œTreatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial.” Wound Repair and Regeneration, 22(5), 613-621, 2014.

    A subsequent phase IIb multicentric clinical trial (HEAL LL-37) further evaluated LL-37 at concentrations of 0.5 and 1.6 mg/mL for venous leg ulcers. GrΓΆnberg et al. (2022) reported that while the overall study cohort did not show statistically significant differences, subgroup analysis of patients with larger ulcers revealed promising healing responses.

    GrΓΆnberg A et al. β€œEvaluation of LL-37 in healing of hard-to-heal venous leg ulcers: a multicentric prospective randomized placebo-controlled clinical trial.” Wound Repair and Regeneration, 30(1), 17-30, 2022.

    Sepsis and Anti-Inflammatory Research

    The immunomodulatory properties of LL-37 have been extensively investigated in the context of sepsis, where the balance between antimicrobial defense and excessive inflammation is critical.

    Kuroda et al. (2016) demonstrated in a polybacterial sepsis mouse model (cecal ligation and puncture) that LL-37 inhibited the pyroptosis of macrophages and improved survival of septic animals. The peptide suppressed inflammatory cytokine production while maintaining antimicrobial function β€” a highly desirable combination for sepsis management.

    Kuroda K et al. β€œAntimicrobial cathelicidin peptide LL-37 inhibits the pyroptosis of macrophages and improves the survival of polybacterial septic mice.” International Immunology, 28(5), 245-253, 2016.

    Further research by Hu et al. (2020) showed that LL-37 ameliorated sepsis in a murine model by stimulating neutrophils to release ectosomes β€” small membrane-derived vesicles that possess antibacterial potential β€” providing yet another mechanism by which the peptide contributes to host defense during systemic infection.

    Hu Z et al. β€œAntimicrobial peptide LL-37 ameliorates a murine sepsis model via decreasing bacterial burden and regulating inflammatory response.” Military Medical Research, 7, 27, 2020.

    Cancer Research

    The role of LL-37 in cancer biology represents a complex and evolving area of investigation. Research has revealed that LL-37 can exhibit either tumor-suppressive or tumor-promoting effects depending on the cancer type, highlighting the peptide’s context-dependent biological activity.

    Wu et al. (2018) published a comprehensive review documenting that LL-37 induces tumorigenic effects in cancers of the ovary, lung, breast, prostate, and pancreas, as well as in malignant melanoma. Conversely, overexpression of LL-37 was associated with tumor-suppressive effects in colon cancer and gastric cancer.

    Wu WKK et al. β€œRoles and mechanisms of human cathelicidin LL-37 in cancer.” Cellular Physiology and Biochemistry, 47(3), 1060-1073, 2018.

    Notably, a phase I/II clinical trial (NCT02225366) has investigated intratumoral injections of LL-37 for the treatment of melanoma, exploring whether the peptide’s immunostimulatory properties could be harnessed to enhance anti-tumor immune responses. Li et al. (2014) demonstrated in preclinical models that LL-37 enhances antitumor effects when combined with CpG oligodeoxynucleotides, an immunostimulatory agent.

    Li N et al. β€œTreatment with LL-37 peptide enhances antitumor effects induced by CpG oligodeoxynucleotides against ovarian cancer.” Journal of Translational Medicine, 12, 85, 2014.

    Research Applications

    Antimicrobial Drug Development

    LL-37 serves as a template for developing next-generation antimicrobial agents. Researchers have created numerous LL-37-derived peptides and analogs with enhanced antimicrobial potency, improved stability against proteolytic degradation, and reduced cytotoxicity. Wang (2014) reported a family of novel antimicrobial compounds obtained by combining peptide library screening with structure-based design using the LL-37 scaffold.

    Wang G. β€œTransformation of human cathelicidin LL-37 into selective, stable, and potent antimicrobial compounds.” ACS Chemical Biology, 9(9), 1997-2002, 2014.

    A major challenge with native LL-37 is its susceptibility to proteolytic degradation and its relatively high cytotoxicity to host cells at antimicrobial concentrations. Research programs are actively engineering LL-37 derivatives that retain antimicrobial and anti-biofilm activity while addressing these limitations. This approach is analogous to how other bioactive peptides like KPV β€” a tripeptide fragment of alpha-melanocyte stimulating hormone β€” represent truncated versions of larger molecules optimized for specific biological activities.

    Immunotherapy and Vaccine Adjuvant Research

    The immunomodulatory properties of LL-37 have generated interest in its potential as a vaccine adjuvant and immunotherapeutic agent. Research has demonstrated that LL-37 can enhance the uptake of nucleic acids by immune cells, promote dendritic cell maturation, and modulate T cell responses β€” all properties relevant to vaccine development.

    Aloul et al. (2022) published a comprehensive review in Frontiers in Immunology exploring the therapeutic potential of upregulating LL-37 expression, including through vitamin D supplementation, for conditions ranging from wound healing to infectious disease. The authors hypothesized that LL-37 upregulation could facilitate efficient clearance of neutrophil extracellular traps (NETs) by macrophages, speeding endothelial repair.

    Aloul KM et al. β€œUpregulating human cathelicidin antimicrobial peptide LL-37 expression and/or its therapeutic use for treatment of inflammation and infectious disease.” Frontiers in Immunology, 13, 880961, 2022.

    Autoimmune Disease Research

    Kahlenberg and Kaplan (2013) reviewed the paradoxical role of LL-37 in autoimmune conditions, particularly psoriasis and systemic lupus erythematosus (SLE). In psoriasis, LL-37 complexes with self-DNA to activate plasmacytoid dendritic cells through TLR9, contributing to the inflammatory cascade. This dual nature β€” protective against infection but potentially pathogenic in autoimmunity β€” is a key focus of ongoing research.

    Kahlenberg JM, Kaplan MJ. β€œLittle peptide, big effects: the role of LL-37 in inflammation and autoimmune disease.” Journal of Immunology, 191(10), 4895-4901, 2013.

    Understanding how LL-37 contributes to both immune defense and autoimmune pathology is critical for developing therapeutic strategies that harness its beneficial properties while minimizing potential adverse effects. This area of investigation aligns with broader research into immunomodulatory peptides, including Thymosin Alpha-1, which has been studied for its ability to modulate immune responses in various disease contexts.

    Comparison with Related Compounds

    LL-37 vs. Other Antimicrobial Peptides

    LL-37 belongs to the broader category of antimicrobial peptides (AMPs), which includes defensins, dermcidin, and histatins in humans. Several key distinctions set LL-37 apart:

    | Feature | LL-37 | Human Defensins (HNPs) | Dermcidin | |β€”β€”β€”|β€”β€”-|β€”β€”β€”β€”β€”β€”β€”-|———–| | Structure | Alpha-helical | Beta-sheet | Mixed | | Length | 37 amino acids | 29-45 amino acids | 47 amino acids | | Primary source | Neutrophils, epithelial cells | Neutrophils | Eccrine sweat glands | | Mechanism | Membrane disruption, pore formation | Membrane disruption, viral aggregation | Membrane disruption | | Vitamin D regulation | Yes | No | No | | Anti-biofilm activity | Strong | Moderate | Limited data |

    Unlike defensins, which require disulfide bonds for structural stability, LL-37’s alpha-helical structure forms upon contact with membranes without the need for disulfide bonds. This structural simplicity makes LL-37 easier to synthesize and modify for research purposes.

    LL-37 vs. Other Immunomodulatory Peptides

    In the landscape of immunomodulatory peptide research, LL-37 can be compared to several other compounds that modulate immune function through different mechanisms:

    • KPV: The tripeptide KPV (Lys-Pro-Val) derived from alpha-MSH shares anti-inflammatory properties with LL-37 but operates through melanocortin receptor pathways rather than direct membrane disruption. Both peptides have been studied for inflammatory bowel conditions.

    • Thymosin Alpha-1: This 28-amino acid peptide enhances immune function through T cell maturation and dendritic cell activation. While LL-37 primarily targets innate immunity, Thymosin Alpha-1 has a more prominent role in adaptive immune modulation.

    • BPC-157: Although BPC-157 is primarily studied for tissue healing and gastroprotection rather than antimicrobial activity, both BPC-157 and LL-37 have been investigated for wound healing applications, with different underlying mechanisms of action.

    • GHK-Cu: The copper-binding tripeptide GHK-Cu promotes tissue remodeling and has anti-inflammatory properties, but lacks the direct antimicrobial activity that defines LL-37’s function.

    LL-37 vs. CRAMP (Mouse Cathelicidin)

    The murine ortholog of LL-37, known as CRAMP (Cathelin-Related Antimicrobial Peptide), is frequently used in animal model research. While CRAMP shares functional homology with LL-37, there are important species-specific differences β€” most notably that the mouse Cnlp gene lacks the vitamin D response element present in the human CAMP gene. This difference means that vitamin D supplementation studies in mice do not directly translate to LL-37 regulation in humans, a critical consideration when interpreting preclinical research data.

    Frequently Asked Questions

    What is LL-37?

    LL-37 is a 37-amino acid antimicrobial peptide and the only member of the cathelicidin family found in humans. It is derived from the C-terminal cleavage of its precursor protein hCAP-18 (human Cationic Antimicrobial Protein of 18 kDa) by the enzyme proteinase 3. LL-37 is produced by neutrophils, epithelial cells, macrophages, and other immune cells as part of the body’s innate immune defense system. Its name comes from its two N-terminal leucine (L) residues and its 37-amino acid length.

    How does LL-37 work in research models?

    In published research, LL-37 exerts its effects through multiple mechanisms. Its primary antimicrobial action involves electrostatic attraction to negatively charged microbial membranes, followed by insertion into and disruption of the lipid bilayer, leading to cell death. Beyond direct antimicrobial activity, research has demonstrated that LL-37 modulates immune cell function by acting as a chemoattractant, influencing cytokine production, activating dendritic cells, and neutralizing bacterial endotoxins. It also promotes wound healing through stimulation of angiogenesis, keratinocyte migration, and re-epithelialization.

    What is the relationship between LL-37 and vitamin D?

    Research has established that vitamin D is a key regulator of LL-37 expression. The landmark 2006 study by Liu et al. in Science demonstrated that Toll-like receptor activation in macrophages triggers a vitamin D-dependent pathway that upregulates cathelicidin/LL-37 production. The human CAMP gene contains a vitamin D response element (VDRE) in its promoter region, making LL-37 one of the most well-characterized gene targets of vitamin D signaling. This connection has significant implications for understanding why vitamin D deficiency is associated with increased infection susceptibility.

    What types of pathogens has LL-37 been studied against?

    Published research has documented LL-37 activity against a remarkably broad spectrum of pathogens. Bacterial targets include Staphylococcus aureus (including MRSA), Pseudomonas aeruginosa, Escherichia coli, Mycobacterium tuberculosis, Streptococcus species, and numerous other Gram-positive and Gram-negative organisms. Antiviral activity has been demonstrated against influenza A virus, respiratory syncytial virus (RSV), HIV-1, and other enveloped viruses. LL-37 also exhibits antifungal activity against Candida species and anti-biofilm effects against multiple bacterial species.

    Has LL-37 been tested in clinical trials?

    Yes, LL-37 has been evaluated in human clinical trials. The most advanced clinical program involved topical LL-37 for chronic venous leg ulcers, including a phase I/II trial (GrΓΆnberg et al., 2014) that demonstrated safety and efficacy in promoting wound healing, and a subsequent phase IIb multicentric trial (GrΓΆnberg et al., 2022). Additionally, a phase I/II clinical trial (NCT02225366) investigated intratumoral injections of LL-37 for melanoma treatment. These trials represent important steps in translating LL-37 research from laboratory findings to potential clinical applications.

    How does LL-37 compare to conventional antibiotics?

    LL-37 differs from conventional antibiotics in several important ways. While traditional antibiotics typically target specific molecular pathways (e.g., cell wall synthesis, protein synthesis, DNA replication), LL-37 disrupts microbial membranes through physical interactions β€” a mechanism that is inherently more difficult for bacteria to develop resistance against. Research by Ridyard and Overhage (2021) noted that while some bacteria can acquire limited resistance to LL-37 through serial passage experiments, the multi-target mechanism makes complete resistance unlikely. Additionally, LL-37 possesses immunomodulatory properties that antibiotics lack, potentially enhancing the overall host defense response.

    What are the current limitations of LL-37 research?

    Several challenges currently limit the therapeutic development of LL-37. These include: susceptibility to proteolytic degradation by host and bacterial proteases, potential cytotoxicity to host cells at high concentrations, inhibition of activity by serum components (particularly high-density lipoprotein), high production costs for the full-length 37-amino acid peptide, and the dual-edged nature of its immunomodulatory effects, which may contribute to autoimmune conditions like psoriasis and lupus in some contexts. Active research programs are addressing these limitations through peptide engineering, novel delivery systems, and the development of shorter LL-37-derived fragments that retain beneficial activity.

    How is LL-37 being studied for drug-resistant infections?

    Given the global crisis of antimicrobial resistance, LL-37 is being actively investigated as both a standalone antimicrobial and a synergistic agent to enhance the activity of conventional antibiotics. Research has shown that LL-37 can potentiate the effects of certain antibiotics, particularly against biofilm-associated infections where conventional drugs alone are ineffective. The anti-biofilm properties of LL-37 are particularly relevant, as biofilm formation is a major mechanism of antibiotic resistance in clinical settings.

    Conclusion

    LL-37 stands as one of the most extensively studied peptides in the field of innate immunity and antimicrobial research. From its discovery as the sole human cathelicidin to its characterization as a multifunctional host defense molecule, the scientific literature has revealed a peptide of remarkable versatility β€” capable of directly killing pathogens, disrupting biofilms, modulating immune responses, promoting wound healing, and influencing cancer biology.

    The published clinical trial data for LL-37 in wound healing, combined with ongoing research into antimicrobial drug development and immunotherapy applications, underscores the translational potential of this endogenous peptide. The critical connection between vitamin D status and LL-37 expression adds another dimension to its significance, linking nutritional biology to antimicrobial defense in ways that continue to generate new research questions.

    As antibiotic resistance continues to threaten global health, research into host defense peptides like LL-37 represents a promising avenue for developing novel therapeutic strategies. The ongoing work to engineer LL-37 derivatives with improved pharmacological properties may ultimately yield new tools for combating drug-resistant infections and modulating immune function.

    For researchers interested in exploring the broader landscape of bioactive peptides, Iron Peak Peptides offers a comprehensive catalog of research-grade compounds, including immunomodulatory peptides like KPV, Thymosin Alpha-1, and tissue repair peptides like BPC-157 and TB-500. Visit the IronPeak Peptides homepage to explore the full selection of research peptides and resources, or consult the peptide research glossary for definitions of key terms used throughout this guide.

    Research Disclaimer

    This article is intended for educational and informational purposes only. All compounds mentioned are for laboratory research use only and are not intended for human consumption. Always consult applicable regulations and institutional guidelines before conducting research with any compounds.

    Related Research


    🔬 Explore Research Peptides

    ← SS-31 (Elamipretide) Research Guide: Mechanism, Studies & Mitochondrial Benefits
    PEG-MGF (PEGylated Mechano Growth Factor): Complete Research Guide β†’